PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna20912.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 296aa    MW: 33513.2 Da    PI: 6.9785
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna20912.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.72.7e-081554340
                             SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHH CS
          Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqc 40
                              WT+eE +l+  a + +  +   +W +Iar+++ g+t  ++
  mrna20912.1-v1.0-hybrid 15 DWTKEENKLFESALAIYDEKtpdRWVKIARMIP-GKTVFDV 54
                             6********************************.***8776 PP

2Myb_DNA-binding42.51.5e-13116160347
                              SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              +WT++E+++++++  q+G+g+W++I+r +   +t+ q+ s+ qky
  mrna20912.1-v1.0-hybrid 116 PWTEDEHLRFLKGLLQYGKGDWRSISRNFVMSKTPTQVASHAQKY 160
                              7*****************************899***********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512939.2221163IPR017884SANT domain
SMARTSM007171.5E-91264IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.1E-41260IPR009057Homeodomain-like
SuperFamilySSF466896.8E-131470IPR009057Homeodomain-like
PfamPF002494.0E-61558IPR001005SANT/Myb domain
CDDcd001673.54E-81661No hitNo description
PROSITE profilePS5129416.922108165IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-9108165IPR009057Homeodomain-like
SuperFamilySSF466891.87E-15111165IPR009057Homeodomain-like
TIGRFAMsTIGR015574.3E-17112164IPR006447Myb domain, plants
SMARTSM007173.0E-9113163IPR001005SANT/Myb domain
CDDcd001674.06E-8116161No hitNo description
PfamPF002499.2E-11116160IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0007134developmental stagesporophyte vegetative stage
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MADTNWFLQE SQSSDWTKEE NKLFESALAI YDEKTPDRWV KIARMIPGKT VFDVFKQYKE  60
LEDDVTNIEA GLVEIPGYQQ TSAFTLELVD DQNFDANRKR SAAARGSDQE RKKGIPWTED  120
EHLRFLKGLL QYGKGDWRSI SRNFVMSKTP TQVASHAQKY FMRQHSGGKD KRRPSIHDIT  180
TVNLTSTTTT SPSQNNNRSP LDQSPPPEHN SKSTESPRVV LDWNIRPNDG VAGAMIFGAT  240
HGDLFESSSP YDVGSPEDLK LHWQNLYAST THYAAHARSP SSMYLMHPSR HQIHG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A4e-1516831178RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00489DAPTransfer from AT5G05790Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004307612.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H73e-88DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLM5X4P21e-151M5X4P2_PRUPE; Uncharacterized protein
STRINGVIT_13s0019g03370.t011e-110(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46634162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G05790.11e-79MYB family protein